PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_18340A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family SBP
Protein Properties Length: 333aa    MW: 35983.1 Da    PI: 8.5756
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_18340AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.56e-4160137178
                                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                +CqvegC  dls ak+yhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  Oropetium_20150105_18340A  60 RCQVEGCGLDLSGAKDYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQP 137
                                6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.1E-3454122IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.44558135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.05E-3959140IPR004333Transcription factor, SBP-box
PfamPF031102.5E-3161134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MEWTAPKPTA SPSSPPLLWD WGDAGAPASG SSGGAPARRG GKEREGKRVK GEEGGGGEVR  60
CQVEGCGLDL SGAKDYHRKH RVCEAHTKCP RVVVAGQERR FCQQCSRFHA LSEFDQKKRS  120
CRRRLSDHNA RRRKPQPDAF AFAPARLPSS LFDDRRQISF VWNKAPLSHV RPFTSPWDSS  180
SDLKLPHGKE IREMSTKVGT IAGQVHLDKS HLSDAISTLS HGKDELLPVK GPDTSITASK  240
FDGAPDLHRA LSLLSAGSCG FPDPAQQASC LIQFSGTSEN SSDPHSPHGG SSALVSCADE  300
QHVTPQSQLV RFTMDASSNG YDSTFYGINQ IN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2651134184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116133KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951747.10.0PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ653Z51e-100SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLK3YU030.0K3YU03_SETIT; Uncharacterized protein
STRINGSi017749m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.49e-42squamosa promoter binding protein-like 10